SCOPe 2.07: Domain d4eoqb2: 4eoq B:310-432

Lineage for d4eoqb2 (4eoq B:310-432)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eoqb2: 4eoq B:310-432 [201921]
   Other proteins in same PDB: d4eoqa1, d4eoqa2, d4eoqc1, d4eoqc2
   automated match to d1h1pb2
   complexed with atp, mg, sgm

Details for d4eoqb2

PDB Entry: 4eoq, 2.15 Å

PDB Description: Thr 160 phosphorylated CDK2 WT - human cyclin A3 complex with ATP

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d4eoqb2:

Sequence; same for both SEQRES and ATOM records:

>d4eoqb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d4eoqb2:

• d4eoqb2 first appeared in SCOPe 2.03
  
• d4eoqb2 appears in SCOPe 2.06
  
• d4eoqb2 appears in the current release, SCOPe 2.08