Lineage for d1aqkl1 (1aqk L:1-111)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 288276Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (8 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 288295Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88537] (1 PDB entry)
  8. 288296Domain d1aqkl1: 1aqk L:1-111 [20192]
    Other proteins in same PDB: d1aqkh1, d1aqkh2, d1aqkl2
    part of Fab B7-15A2

Details for d1aqkl1

PDB Entry: 1aqk (more details), 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

SCOP Domain Sequences for d1aqkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqkl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 3.1}
envltqppsvsgapgqrvtisctgsnsnigagftvhwyqhlpgtapkllifantnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsarfgggtrltvlg

SCOP Domain Coordinates for d1aqkl1:

Click to download the PDB-style file with coordinates for d1aqkl1.
(The format of our PDB-style files is described here.)

Timeline for d1aqkl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aqkl2