![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab B7-15A2 (human), lambda L chain [48838] (1 PDB entry) |
![]() | Domain d1aqkl1: 1aqk L:1-111 [20192] Other proteins in same PDB: d1aqkh2, d1aqkl2 |
PDB Entry: 1aqk (more details), 1.84 Å
SCOP Domain Sequences for d1aqkl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqkl1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Fab B7-15A2 (human), lambda L chain} envltqppsvsgapgqrvtisctgsnsnigagftvhwyqhlpgtapkllifantnrpsgv pdrfsgsksgtsaslaitglqaedeadyycqsydsslsarfgggtrltvlg
Timeline for d1aqkl1: