SCOPe 2.08: Domain d1aqkl1: 1aqk L:1-111

Lineage for d1aqkl1 (1aqk L:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88537] (1 PDB entry)

8. Domain d1aqkl1: 1aqk L:1-111 [20192]
   Other proteins in same PDB: d1aqkh1, d1aqkh2, d1aqkl2
   part of Fab B7-15A2

Details for d1aqkl1

PDB Entry: 1aqk, 1.84 Å

PDB Description: three-dimensional structure of a human fab with high affinity for tetanus toxoid

PDB Compounds: (L:) fab b7-15a2

SCOPe Domain Sequences for d1aqkl1:

Sequence; same for both SEQRES and ATOM records:

>d1aqkl1 b.1.1.1 (L:1-111) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
envltqppsvsgapgqrvtisctgsnsnigagftvhwyqhlpgtapkllifantnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsarfgggtrltvlg

Timeline for d1aqkl1:

• d1aqkl1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqkl1 appears in SCOPe 2.07