Lineage for d2h1ph1 (2h1p H:301-420)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782083Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (54 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 782113Domain d2h1ph1: 2h1p H:301-420 [20191]
    Other proteins in same PDB: d2h1ph2, d2h1pl1, d2h1pl2
    part of polysaccharide binding antibody 2H1

Details for d2h1ph1

PDB Entry: 2h1p (more details), 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes
PDB Compounds: (H:) 2h1

SCOP Domain Sequences for d2h1ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ph1 b.1.1.1 (H:301-420) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss

SCOP Domain Coordinates for d2h1ph1:

Click to download the PDB-style file with coordinates for d2h1ph1.
(The format of our PDB-style files is described here.)

Timeline for d2h1ph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h1ph2