SCOPe 2.07: Domain d4eond2: 4eon D:310-431

Lineage for d4eond2 (4eon D:310-431)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eond2: 4eon D:310-431 [201909]
   Other proteins in same PDB: d4eona1, d4eona2, d4eonc1, d4eonc2
   automated match to d1h1pb2
   complexed with 1ro, mg

Details for d4eond2

PDB Entry: 4eon, 2.4 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, q131e - human cyclin a3 complex with the inhibitor ro3306

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eond2:

Sequence; same for both SEQRES and ATOM records:

>d4eond2 a.74.1.1 (D:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
ln

Timeline for d4eond2:

• d4eond2 first appeared in SCOPe 2.03
  
• d4eond2 appears in SCOPe 2.06
  
• d4eond2 appears in the current release, SCOPe 2.08