Lineage for d4eoma_ (4eom A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672328Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 1672329Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
    Uniprot P24941
  8. 1672576Domain d4eoma_: 4eom A: [201901]
    Other proteins in same PDB: d4eomb1, d4eomb2, d4eomd1, d4eomd2
    automated match to d4eomc_
    complexed with atp, mg

Details for d4eoma_

PDB Entry: 4eom (more details), 2.1 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, q131e - human cyclin a3 complex with atp
PDB Compounds: (A:) cyclin-dependent kinase 2

SCOPe Domain Sequences for d4eoma_:

Sequence, based on SEQRES records: (download)

>d4eoma_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkel
nhpnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafc
hshrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgck
yystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykp
sfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

Sequence, based on observed residues (ATOM records): (download)

>d4eoma_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
gsmenfqkvekigegtygvvykarnkltgevvalkkirletegvpstaireisllkelnh
pnivklldvihtenklylvfeflsmdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpenllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr

SCOPe Domain Coordinates for d4eoma_:

Click to download the PDB-style file with coordinates for d4eoma_.
(The format of our PDB-style files is described here.)

Timeline for d4eoma_: