SCOP 1.73: Domain d2h1pl1: 2h1p L:1-113

Lineage for d2h1pl1 (2h1p L:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d2h1pl1: 2h1p L:1-113 [20190]
   Other proteins in same PDB: d2h1ph1, d2h1ph2, d2h1pl2
   part of polysaccharide binding antibody 2H1

Details for d2h1pl1

PDB Entry: 2h1p, 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

PDB Compounds: (L:) 2h1

SCOP Domain Sequences for d2h1pl1:

Sequence; same for both SEQRES and ATOM records:

>d2h1pl1 b.1.1.1 (L:1-113) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqtplslpvslgdpasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
sgvpdkfsgsgsgtdftlkisrveaedqgvyfcsqsthvpwtfgggtkleikr

Timeline for d2h1pl1:

• d2h1pl1 first appeared (with stable ids) in SCOP 1.55
  
• d2h1pl1 appears in SCOP 1.71
  
• d2h1pl1 appears in SCOP 1.75
  
• d2h1pl1 appears in the current release, SCOPe 2.08