Lineage for d4eokd1 (4eok D:176-309)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739685Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1739686Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1739687Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1739700Protein Cyclin A [47956] (2 species)
  7. 1739736Species Human (Homo sapiens) [TaxId:9606] [47957] (75 PDB entries)
    Uniprot P20248 175-432
  8. 1739945Domain d4eokd1: 4eok D:176-309 [201899]
    Other proteins in same PDB: d4eoka_, d4eokc_
    automated match to d1h1pb1
    complexed with 4sp, sgm

Details for d4eokd1

PDB Entry: 4eok (more details), 2.57 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor nu6102
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eokd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eokd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d4eokd1:

Click to download the PDB-style file with coordinates for d4eokd1.
(The format of our PDB-style files is described here.)

Timeline for d4eokd1: