SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4eojd2 (4eoj D:310-431)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000824Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2000825Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2000826Family a.74.1.1: Cyclin [47955] (9 protein domains)
  6. 2000839Protein Cyclin A [47956] (2 species)
  7. 2000875Species Human (Homo sapiens) [TaxId:9606] [47957] (78 PDB entries)
    Uniprot P20248 175-432
  8. 2000883Domain d4eojd2: 4eoj D:310-431 [201895]
    Other proteins in same PDB: d4eoja1, d4eoja2, d4eojc1, d4eojc2
    automated match to d1h1pb2
    complexed with atp, mg, sgm

Details for d4eojd2

PDB Entry: 4eoj (more details), 1.65 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with atp
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eojd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eojd2 a.74.1.1 (D:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
ln

SCOPe Domain Coordinates for d4eojd2:

Click to download the PDB-style file with coordinates for d4eojd2.
(The format of our PDB-style files is described here.)

Timeline for d4eojd2: