Class a: All alpha proteins [46456] (289 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries) Uniprot P20248 175-432 |
Domain d4eojd1: 4eoj D:176-309 [201894] Other proteins in same PDB: d4eoja1, d4eoja2, d4eojc1, d4eojc2 automated match to d1h1pb1 complexed with atp, mg, sgm |
PDB Entry: 4eoj (more details), 1.65 Å
SCOPe Domain Sequences for d4eojd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eojd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaap
Timeline for d4eojd1: