Lineage for d4eojd1 (4eoj D:176-309)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003401Protein Cyclin A [47956] (2 species)
  7. 2003437Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2003444Domain d4eojd1: 4eoj D:176-309 [201894]
    Other proteins in same PDB: d4eoja1, d4eoja2, d4eojc1, d4eojc2
    automated match to d1h1pb1
    complexed with atp, mg, sgm

Details for d4eojd1

PDB Entry: 4eoj (more details), 1.65 Å

PDB Description: thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with atp
PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eojd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eojd1 a.74.1.1 (D:176-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvltfdlaap

SCOPe Domain Coordinates for d4eojd1:

Click to download the PDB-style file with coordinates for d4eojd1.
(The format of our PDB-style files is described here.)

Timeline for d4eojd1: