SCOPe 2.07: Domain d4eoid2: 4eoi D:310-432

Lineage for d4eoid2 (4eoi D:310-432)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
   Uniprot P20248 175-432

8. Domain d4eoid2: 4eoi D:310-432 [201891]
   Other proteins in same PDB: d4eoia1, d4eoia2, d4eoic1, d4eoic2
   automated match to d1h1pb2
   complexed with 1ro, dms, sgm

Details for d4eoid2

PDB Entry: 4eoi, 2 Å

PDB Description: Thr 160 phosphorylated CDK2 K89D, Q131E - human cyclin A3 complex with the inhibitor RO3306

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d4eoid2:

Sequence; same for both SEQRES and ATOM records:

>d4eoid2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d4eoid2:

• d4eoid2 first appeared in SCOPe 2.03
  
• d4eoid2 appears in SCOPe 2.06
  
• d4eoid2 appears in the current release, SCOPe 2.08