Lineage for d1nfdh1 (1nfd H:1-114)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52367Species Fab H57 (hamster), lambda L chain [48836] (1 PDB entry)
  8. 52371Domain d1nfdh1: 1nfd H:1-114 [20189]
    Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf2, d1nfdg2, d1nfdh2

Details for d1nfdh1

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfdh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab H57 (hamster), lambda L chain}
evylvesggdlvqpgsslkvscaasgftfsdfwmywvrqapgkglewvgriknipnnyat
eyadsvrgrftisrddsrnsiylqmnrlrvddtaiyyctragrfdhfdywgqgtmvtvss
a

SCOP Domain Coordinates for d1nfdh1:

Click to download the PDB-style file with coordinates for d1nfdh1.
(The format of our PDB-style files is described here.)

Timeline for d1nfdh1: