Lineage for d4eo5b1 (4eo5 B:61-135)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312023Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (12 PDB entries)
  8. 2312025Domain d4eo5b1: 4eo5 B:61-135 [201884]
    Other proteins in same PDB: d4eo5a1, d4eo5a2, d4eo5b2
    automated match to d2io5b_
    complexed with act, gol; mutant

Details for d4eo5b1

PDB Entry: 4eo5 (more details), 2.35 Å

PDB Description: Yeast Asf1 bound to H3/H4G94P mutant
PDB Compounds: (B:) Histone H3.2

SCOPe Domain Sequences for d4eo5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eo5b1 a.22.1.1 (B:61-135) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

SCOPe Domain Coordinates for d4eo5b1:

Click to download the PDB-style file with coordinates for d4eo5b1.
(The format of our PDB-style files is described here.)

Timeline for d4eo5b1: