SCOPe 2.08: Domain d4eo5b1: 4eo5 B:61-135

Lineage for d4eo5b1 (4eo5 B:61-135)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (11 PDB entries)

8. Domain d4eo5b1: 4eo5 B:61-135 [201884]
   Other proteins in same PDB: d4eo5a1, d4eo5a2, d4eo5b2
   automated match to d2io5b_
   complexed with act, gol; mutant

Details for d4eo5b1

PDB Entry: 4eo5, 2.35 Å

PDB Description: Yeast Asf1 bound to H3/H4G94P mutant

PDB Compounds: (B:) Histone H3.2

SCOPe Domain Sequences for d4eo5b1:

Sequence; same for both SEQRES and ATOM records:

>d4eo5b1 a.22.1.1 (B:61-135) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

Timeline for d4eo5b1:

• d4eo5b1 first appeared in SCOPe 2.03, called d4eo5b_
  
• d4eo5b1 appears in SCOPe 2.07