Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries) |
Domain d4en3c2: 4en3 C:184-277 [201883] Other proteins in same PDB: d4en3a1, d4en3a2, d4en3a3, d4en3b1, d4en3b2, d4en3c1, d4en3d_ automated match to d1onqa1 complexed with agh, fuc, gol, nag |
PDB Entry: 4en3 (more details), 2.57 Å
SCOPe Domain Sequences for d4en3c2:
Sequence, based on SEQRES records: (download)
>d4en3c2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlyw
>d4en3c2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrgpsplllvchvsgfypkpvwvkwmrqqgtqpgdilpnadetwylratldv vaaglscrvkhsslegqdivlyw
Timeline for d4en3c2: