Lineage for d4en3b2 (4en3 B:118-242)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025149Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 2025538Domain d4en3b2: 4en3 B:118-242 [201881]
    Other proteins in same PDB: d4en3a1, d4en3a2, d4en3b1, d4en3c1, d4en3c2
    automated match to d1ktke2
    complexed with agh, fuc, gol, nag

Details for d4en3b2

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
PDB Compounds: (B:) human nkt tcr beta chain

SCOPe Domain Sequences for d4en3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4en3b2 b.1.1.2 (B:118-242) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeaw

SCOPe Domain Coordinates for d4en3b2:

Click to download the PDB-style file with coordinates for d4en3b2.
(The format of our PDB-style files is described here.)

Timeline for d4en3b2: