SCOPe 2.08: Domain d4en3b2: 4en3 B:118-242

Lineage for d4en3b2 (4en3 B:118-242)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein beta2-microglobulin [88600] (7 species)
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries)
Uniprot P61769 21-119 ! Uniprot P01884
Domain d4en3b2: 4en3 B:118-242 [201881]
Other proteins in same PDB: d4en3a1, d4en3a2, d4en3a3, d4en3b1, d4en3c1, d4en3c2
automated match to d1ktke2
complexed with agh, fuc, gol, nag

Details for d4en3b2

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide

PDB Compounds: (B:) human nkt tcr beta chain

SCOPe Domain Sequences for d4en3b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4en3b2 b.1.1.2 (B:118-242) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeaw

SCOPe Domain Coordinates for d4en3b2:

Click to download the PDB-style file with coordinates for d4en3b2.
(The format of our PDB-style files is described here.)

Timeline for d4en3b2: