![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (472 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d4en3b2: 4en3 B:118-242 [201881] Other proteins in same PDB: d4en3a1, d4en3a2, d4en3a3, d4en3b1, d4en3c1, d4en3c2 automated match to d1ktke2 complexed with agh, fuc, gol, nag |
PDB Entry: 4en3 (more details), 2.57 Å
SCOPe Domain Sequences for d4en3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4en3b2 b.1.1.2 (B:118-242) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeaw
Timeline for d4en3b2: