Lineage for d4en3b1 (4en3 B:2-117)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2357006Domain d4en3b1: 4en3 B:2-117 [201880]
    Other proteins in same PDB: d4en3a2, d4en3a3, d4en3b2, d4en3c1, d4en3c2, d4en3d_
    automated match to d1ktke1
    complexed with agh, fuc, gol, nag

Details for d4en3b1

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
PDB Compounds: (B:) human nkt tcr beta chain

SCOPe Domain Sequences for d4en3b1:

Sequence, based on SEQRES records: (download)

>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
sestvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte

Sequence, based on observed residues (ATOM records): (download)

>d4en3b1 b.1.1.0 (B:2-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adiyqtprylvigtgkkitlecsqtmghdkmywyqqdpgmelhlihysygvnstekgdls
estvsrirtehfpltlesarpshtsqylcassensgtgriyeqyfgpgtrltvte

SCOPe Domain Coordinates for d4en3b1:

Click to download the PDB-style file with coordinates for d4en3b1.
(The format of our PDB-style files is described here.)

Timeline for d4en3b1: