![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Fab H57 (hamster), lambda L chain [48836] (1 PDB entry) |
![]() | Domain d1nfdg1: 1nfd G:2-107 [20188] Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde2, d1nfdf2, d1nfdg2, d1nfdh2 |
PDB Entry: 1nfd (more details), 2.8 Å
SCOP Domain Sequences for d1nfdg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfdg1 b.1.1.1 (G:2-107) Immunoglobulin (variable domains of L and H chains) {Fab H57 (hamster), lambda L chain} yeliqpssasvtvgetvkitcsgdqlpknfaywfqqksdknillliymdnkrpsgiperf sgstsgttatltisgaqpedeaayyclssygdnndlvfgsgtqltvlr
Timeline for d1nfdg1: