Lineage for d4en3a2 (4en3 A:114-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751122Domain d4en3a2: 4en3 A:114-182 [201879]
    Other proteins in same PDB: d4en3a1, d4en3a3, d4en3b1, d4en3b2, d4en3c1, d4en3c2, d4en3d_
    automated match to d1qrnd2
    complexed with agh, fuc, gol, nag

Details for d4en3a2

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
PDB Compounds: (A:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4en3a2:

Sequence, based on SEQRES records: (download)

>d4en3a2 b.1.1.2 (A:114-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksd

Sequence, based on observed residues (ATOM records): (download)

>d4en3a2 b.1.1.2 (A:114-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdvyitdkcvldmrmdfksnsavawsnk
sd

SCOPe Domain Coordinates for d4en3a2:

Click to download the PDB-style file with coordinates for d4en3a2.
(The format of our PDB-style files is described here.)

Timeline for d4en3a2: