SCOPe 2.06: Domain d4en3a1: 4en3 A:8-113

Lineage for d4en3a1 (4en3 A:8-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4en3a1: 4en3 A:8-113 [201878]
   Other proteins in same PDB: d4en3a2, d4en3b2, d4en3c1, d4en3c2, d4en3d_
   automated match to d1qrnd1
   complexed with agh, fuc, gol, nag

Details for d4en3a1

PDB Entry: 4en3, 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide

PDB Compounds: (A:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4en3a1:

Sequence; same for both SEQRES and ATOM records:

>d4en3a1 b.1.1.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
kksssllitasraadtasyfcatydrgstlgrlyfgrgtqltvwpd

Timeline for d4en3a1:

• d4en3a1 first appeared in SCOPe 2.03
  
• d4en3a1 appears in SCOPe 2.05
  
• d4en3a1 appears in SCOPe 2.07
  
• d4en3a1 appears in the current release, SCOPe 2.08