Lineage for d4en3a1 (4en3 A:8-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296444Domain d4en3a1: 4en3 A:8-113 [201878]
    Other proteins in same PDB: d4en3a2, d4en3b2, d4en3c1, d4en3c2, d4en3d_
    automated match to d1qrnd1
    complexed with agh, fuc, gol, nag

Details for d4en3a1

PDB Entry: 4en3 (more details), 2.57 Å

PDB Description: crystal structure of a human valpha24(-) nkt tcr in complex with cd1d/alpha-galactosylceramide
PDB Compounds: (A:) human nkt tcr alpha chain

SCOPe Domain Sequences for d4en3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4en3a1 b.1.1.0 (A:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
kksssllitasraadtasyfcatydrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d4en3a1:

Click to download the PDB-style file with coordinates for d4en3a1.
(The format of our PDB-style files is described here.)

Timeline for d4en3a1: