Lineage for d4en2a_ (4en2 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034700Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 2034712Family b.2.7.0: automated matches [195107] (1 protein)
    not a true family
  6. 2034713Protein automated matches [195108] (2 species)
    not a true protein
  7. 2034716Species Mouse (Mus musculus) [TaxId:10090] [195109] (2 PDB entries)
  8. 2034717Domain d4en2a_: 4en2 A: [201877]
    automated match to d4en2m_

Details for d4en2a_

PDB Entry: 4en2 (more details), 2.58 Å

PDB Description: hiv-1 nef in complex with mhc-i cytoplasmic domain and mu1 adaptin subunit of ap1 adaptor (second domain)
PDB Compounds: (A:) AP-1 complex subunit mu-1

SCOPe Domain Sequences for d4en2a_:

Sequence, based on SEQRES records: (download)

>d4en2a_ b.2.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkvl
fdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliwi
esviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpens
eivwsvksfpggkeylmrahfglpsveaedkegkppisvkfeipyfttsgiqvrylkiie
ksgyqalpwvryitqngdyqlrtq

Sequence, based on observed residues (ATOM records): (download)

>d4en2a_ b.2.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rsegikyrknevfldvieavnllvsangnvlrseivgsikmrvflsgmpelrlglndkvl
fdntgrgksksveledvkfhqcvrlsrfendrtisfippdgefelmsyrlnthvkpliwi
esviekhshsrieymvkaksqfkrrstannveihipvpndadspkfkttvgsvkwvpens
eivwsvksfpggkeylmrahfglpkppisvkfeipyfttsgiqvrylkiieksgyqalpw
vryitqngdyqlrtq

SCOPe Domain Coordinates for d4en2a_:

Click to download the PDB-style file with coordinates for d4en2a_.
(The format of our PDB-style files is described here.)

Timeline for d4en2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4en2m_