Lineage for d4emmc_ (4emm C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1353897Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 1353898Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 1354012Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries)
  8. 1354036Domain d4emmc_: 4emm C: [201864]
    automated match to d4emma_

Details for d4emmc_

PDB Entry: 4emm (more details), 2.4 Å

PDB Description: Crystal structure of Staphylococcus aureus ClpP in compact conformation
PDB Compounds: (C:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d4emmc_:

Sequence, based on SEQRES records: (download)

>d4emmc_ c.14.1.1 (C:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d4emmc_ c.14.1.1 (C:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptvieraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspgg
svtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqpliaa
nhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

SCOPe Domain Coordinates for d4emmc_:

Click to download the PDB-style file with coordinates for d4emmc_.
(The format of our PDB-style files is described here.)

Timeline for d4emmc_: