Lineage for d4elza_ (4elz A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953229Fold e.11: Type II DNA topoisomerase C-terminal domain-like [56718] (1 superfamily)
    4 domains: (1) toprim alpha/beta; (2) "winged helix"-like; (3) alpha+beta; (4) all-alpha
  4. 1953230Superfamily e.11.1: Type II DNA topoisomerase C-terminal domain-like [56719] (2 families) (S)
  5. 1953231Family e.11.1.1: Type II DNA topoisomerase C-terminal domain-like [56720] (3 proteins)
    domain 2 contains the catalytic tyrosine residue
  6. 1953256Protein automated matches [191158] (5 species)
    not a true protein
  7. 1953269Species Vibrio fischeri [TaxId:312309] [226391] (1 PDB entry)
  8. 1953270Domain d4elza_: 4elz A: [201859]
    Other proteins in same PDB: d4elzc_, d4elzd_
    automated match to d1x75a1
    complexed with gol

Details for d4elza_

PDB Entry: 4elz (more details), 2.2 Å

PDB Description: ccdbvfi:gyra14vfi
PDB Compounds: (A:) DNA gyrase subunit A

SCOPe Domain Sequences for d4elza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elza_ e.11.1.1 (A:) automated matches {Vibrio fischeri [TaxId: 312309]}
ssglvprgshmtrrtifelrkardrahileglalalanideiieliknaptpaeakegli
srgwdlgnvasmleragtdaarpdwlepefgiregkyflteqqaqailelrlhrltgleh
ekildeykalldeiaelmhilas

SCOPe Domain Coordinates for d4elza_:

Click to download the PDB-style file with coordinates for d4elza_.
(The format of our PDB-style files is described here.)

Timeline for d4elza_: