Lineage for d4ejla_ (4ejl A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796180Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries)
  8. 1796272Domain d4ejla_: 4ejl A: [201850]
    automated match to d4ejlb_
    complexed with dms, gol, iop, peg

Details for d4ejla_

PDB Entry: 4ejl (more details), 2.44 Å

PDB Description: apo hiv protease (pr) dimer in closed form with fragment 1f1-n in the outside/top of flap
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d4ejla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ejla_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d4ejla_:

Click to download the PDB-style file with coordinates for d4ejla_.
(The format of our PDB-style files is described here.)

Timeline for d4ejla_: