Lineage for d4ej0i_ (4ej0 I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846421Species Burkholderia thailandensis [TaxId:271848] [196827] (2 PDB entries)
  8. 2846430Domain d4ej0i_: 4ej0 I: [201847]
    automated match to d4ej0b_
    complexed with nap

Details for d4ej0i_

PDB Entry: 4ej0 (more details), 2.61 Å

PDB Description: Crystal structure of ADP-L-glycero-D-manno-heptose-6-epimerase from Burkholderia thailandensis
PDB Compounds: (I:) ADP-l-glycero-d-manno-heptose-6-epimerase

SCOPe Domain Sequences for d4ej0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ej0i_ c.2.1.0 (I:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
mtlivtgaagfiganlvkalnergetriiavdnltradkfknlvdceiddyldktefver
fargdfgkvravfhegacsdtmetdgrymmdnnfrysravldaclaqgaqflyassaaiy
ggssrfveereveaplnvygyskflfdqvirrvmpgaksqiagfryfnvygpreshkgrm
asvafhnfnqfraegkvklfgeysgygpgeqtrdfvsvedvakvnlyffdhpeksgifnl
gtgraqpfndiaatvvntlralegqpaltlaeqveqglveyvpfpdalrgkyqcftqadq
tklraagydapfltvqegvdryvrwlfgql

SCOPe Domain Coordinates for d4ej0i_:

Click to download the PDB-style file with coordinates for d4ej0i_.
(The format of our PDB-style files is described here.)

Timeline for d4ej0i_: