SCOPe 2.08: Domain d1ap2c_: 1ap2 C:

Lineage for d1ap2c_ (1ap2 C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d1ap2c_: 1ap2 C: [20184]
   Other proteins in same PDB: d1ap2b_, d1ap2d_
   part of P-glycoprotein-specific scFv C219

Details for d1ap2c_

PDB Entry: 1ap2, 2.36 Å

PDB Description: single chain fv of c219

PDB Compounds: (C:) monoclonal antibody c219

SCOPe Domain Sequences for d1ap2c_:

Sequence; same for both SEQRES and ATOM records:

>d1ap2c_ b.1.1.1 (C:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklepg

Timeline for d1ap2c_:

• d1ap2c_ first appeared (with stable ids) in SCOP 1.55
  
• d1ap2c_ appears in SCOPe 2.07