SCOPe 2.05: Domain d4ef1a_: 4ef1 A:

Lineage for d4ef1a_ (4ef1 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [195543] (4 PDB entries)

8. Domain d4ef1a_: 4ef1 A: [201836]
   automated match to d4ef1b_
   complexed with mse

Details for d4ef1a_

PDB Entry: 4ef1, 1.9 Å

PDB Description: crystal structure of a pheromone cob1 precursor/lipoprotein, yaec family (ef2496) from enterococcus faecalis v583 at 1.90 a resolution

PDB Compounds: (A:) Pheromone cOB1/lipoprotein, YaeC family

SCOPe Domain Sequences for d4ef1a_:

Sequence; same for both SEQRES and ATOM records:

>d4ef1a_ c.94.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
ddsvlkvgaspvphaeilehvkpllekegvklevttytdyvlpnkalesgdidanyfqhv
pffneavkendydfvnagaihlepvglyskkykslqeipdgstiyvsssvsdwprvltil
edaglitlkegvdrttatfddidkntkklkfnhesdpaimttlydneegaavlinsnfav
dqglnpkkdaialekesspyaniiavrkedennenvkklvkvlrskevqdwitkkwngai
vpvne

Timeline for d4ef1a_:

• d4ef1a_ first appeared in SCOPe 2.03
  
• d4ef1a_ appears in SCOPe 2.04
  
• d4ef1a_ appears in SCOPe 2.06
  
• d4ef1a_ appears in the current release, SCOPe 2.08