SCOP 1.59: Domain d1ap2b_: 1ap2 B:

Lineage for d1ap2b_ (1ap2 B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries)

8. Domain d1ap2b_: 1ap2 B: [20183]

Details for d1ap2b_

PDB Entry: 1ap2, 2.4 Å

PDB Description: single chain fv of c219

SCOP Domain Sequences for d1ap2b_:

Sequence; same for both SEQRES and ATOM records:

>d1ap2b_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp

Timeline for d1ap2b_:

• d1ap2b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ap2b_ appears in SCOP 1.57
  
• d1ap2b_ appears in SCOP 1.61
  
• d1ap2b_ appears in the current release, SCOPe 2.08