Lineage for d4eb2b2 (4eb2 B:138-263)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1791069Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1791070Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1791233Protein automated matches [190608] (3 species)
    not a true protein
  7. 1791254Species European mistletoe (Viscum album) [TaxId:3972] [225471] (5 PDB entries)
  8. 1791256Domain d4eb2b2: 4eb2 B:138-263 [201826]
    Other proteins in same PDB: d4eb2a_
    automated match to d1sz6b2
    complexed with azi, cl, edo, gol, nag, peg, so4

Details for d4eb2b2

PDB Entry: 4eb2 (more details), 1.94 Å

PDB Description: crystal structure mistletoe lectin i from viscum album in complex with n-acetyl-d-glucosamine at 1.94 a resolution.
PDB Compounds: (B:) Beta-galactoside-specific lectin 1 chain B

SCOPe Domain Sequences for d4eb2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb2b2 b.42.2.1 (B:138-263) automated matches {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesaggsvqvetctagqenqrwalygdgsirpkqnqsqcltngrd
svstvinivscsagssgqrwvftnagailnlknglamdvaqanpalariiiypatgnpnq
mwlpvp

SCOPe Domain Coordinates for d4eb2b2:

Click to download the PDB-style file with coordinates for d4eb2b2.
(The format of our PDB-style files is described here.)

Timeline for d4eb2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eb2b1
View in 3D
Domains from other chains:
(mouse over for more information)
d4eb2a_