SCOPe 2.08: Domain d4eagc2: 4eag C:182-324

Lineage for d4eagc2 (4eag C:182-324)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
   Uniprot P80385 182-326! Uniprot P80385 23-181

8. Domain d4eagc2: 4eag C:182-324 [201820]
   Other proteins in same PDB: d4eaga_
   automated match to d2v8qe1
   complexed with atp, tam

Details for d4eagc2

PDB Entry: 4eag, 2.7 Å

PDB Description: Co-crystal structure of an chimeric AMPK core with ATP

PDB Compounds: (C:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d4eagc2:

Sequence, based on SEQRES records:

>d4eagc2 d.37.1.1 (C:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv
vdehdvvkgivslsdilqalvlt

Sequence, based on observed residues (ATOM records):

>d4eagc2 d.37.1.1 (C:182-324) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaanldvsvtkalqhrgvlkcylhetleaiinrlveaevhrlvvvdehdvvkgi
vslsdilqalvlt

Timeline for d4eagc2:

• d4eagc2 first appeared in SCOPe 2.03
  
• d4eagc2 appears in SCOPe 2.07