Lineage for d2ap2d_ (2ap2 D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546842Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (33 PDB entries)
  8. 546866Domain d2ap2d_: 2ap2 D: [20181]
    Other proteins in same PDB: d2ap2a_, d2ap2c_
    part of P-glycoprotein-specific scFv C219

Details for d2ap2d_

PDB Entry: 2ap2 (more details), 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide

SCOP Domain Sequences for d2ap2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ap2d_ b.1.1.1 (D:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

SCOP Domain Coordinates for d2ap2d_:

Click to download the PDB-style file with coordinates for d2ap2d_.
(The format of our PDB-style files is described here.)

Timeline for d2ap2d_: