Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries) |
Domain d2ap2d_: 2ap2 D: [20181] |
PDB Entry: 2ap2 (more details), 2.4 Å
SCOP Domain Sequences for d2ap2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ap2d_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain} evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp sg
Timeline for d2ap2d_: