SCOP 1.59: Domain d2ap2d_: 2ap2 D:

Lineage for d2ap2d_ (2ap2 D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries)

8. Domain d2ap2d_: 2ap2 D: [20181]

Details for d2ap2d_

PDB Entry: 2ap2, 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide

SCOP Domain Sequences for d2ap2d_:

Sequence; same for both SEQRES and ATOM records:

>d2ap2d_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain}
evqlqqsgaelvrpgasvklsctasgfnikddfmhwvkqrpeqglewigridpandntky
apkfqdkatiiadtssntaylqlssltsedtavyycarrevysyyspldvwgagttvtvp
sg

Timeline for d2ap2d_:

• d2ap2d_ first appeared (with stable ids) in SCOP 1.55
  
• d2ap2d_ appears in SCOP 1.57
  
• d2ap2d_ appears in SCOP 1.61
  
• d2ap2d_ last appears in SCOPe 2.07