Lineage for d4e4me_ (4e4m E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2985264Domain d4e4me_: 4e4m E: [201797]
    automated match to d4e4ma_
    complexed with 0nh

Details for d4e4me_

PDB Entry: 4e4m (more details), 2.25 Å

PDB Description: JAK2 kinase (JH1 domain) in complex with compound 30
PDB Compounds: (E:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d4e4me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4me_ d.144.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afedrdptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrd
fereieilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikll
qytsqickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepg
espifwyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmi
vfhliellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdnmag

SCOPe Domain Coordinates for d4e4me_:

Click to download the PDB-style file with coordinates for d4e4me_.
(The format of our PDB-style files is described here.)

Timeline for d4e4me_: