SCOP 1.63: Domain d2ap2a_: 2ap2 A:

Lineage for d2ap2a_ (2ap2 A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species scFv C219, (mouse sequence-based), kappa L chain [48835] (2 PDB entries)
   P-glycoprotein-specific

8. Domain d2ap2a_: 2ap2 A: [20178]

Details for d2ap2a_

PDB Entry: 2ap2, 2.4 Å

PDB Description: single chain fv of c219 in complex with synthetic epitope peptide

SCOP Domain Sequences for d2ap2a_:

Sequence; same for both SEQRES and ATOM records:

>d2ap2a_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {scFv C219, (mouse sequence-based), kappa L chain}
fvrdivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywa
stresgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklep

Timeline for d2ap2a_:

• d2ap2a_ first appeared (with stable ids) in SCOP 1.55
  
• d2ap2a_ appears in SCOP 1.61
  
• d2ap2a_ appears in SCOP 1.65
  
• d2ap2a_ appears in the current release, SCOPe 2.08, called d2ap2a1