Lineage for d1mf2n1 (1mf2 N:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158172Species Fab F11.2.32 (mouse), kappa L chain [48834] (2 PDB entries)
  8. 158180Domain d1mf2n1: 1mf2 N:1-113 [20177]
    Other proteins in same PDB: d1mf2h2, d1mf2l2, d1mf2m2, d1mf2n2

Details for d1mf2n1

PDB Entry: 1mf2 (more details), 2.6 Å

PDB Description: anti hiv1 protease fab complex

SCOP Domain Sequences for d1mf2n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf2n1 b.1.1.1 (N:1-113) Immunoglobulin (variable domains of L and H chains) {Fab F11.2.32 (mouse), kappa L chain}
dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
vtvss

SCOP Domain Coordinates for d1mf2n1:

Click to download the PDB-style file with coordinates for d1mf2n1.
(The format of our PDB-style files is described here.)

Timeline for d1mf2n1: