Lineage for d4e1od_ (4e1o D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614576Species Human (Homo sapiens) [TaxId:9606] [188446] (17 PDB entries)
  8. 1614580Domain d4e1od_: 4e1o D: [201768]
    automated match to d4e1oc_
    complexed with plp, pvh

Details for d4e1od_

PDB Entry: 4e1o (more details), 1.8 Å

PDB Description: Human histidine decarboxylase complex with Histidine methyl ester (HME)
PDB Compounds: (D:) histidine decarboxylase

SCOPe Domain Sequences for d4e1od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1od_ c.67.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswdsifg
dieriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactelemnv
mdwlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepdades
slnarlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrglvpv
fvcatlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieyadsf
tfnpskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrrfrs
vklwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgpnsl
tenvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlilsq

SCOPe Domain Coordinates for d4e1od_:

Click to download the PDB-style file with coordinates for d4e1od_.
(The format of our PDB-style files is described here.)

Timeline for d4e1od_: