Lineage for d4e1ob1 (4e1o B:2-477)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897228Species Human (Homo sapiens) [TaxId:9606] [188446] (28 PDB entries)
  8. 2897230Domain d4e1ob1: 4e1o B:2-477 [201767]
    Other proteins in same PDB: d4e1oa2, d4e1ob2, d4e1oc2, d4e1od2, d4e1oe2, d4e1of2
    automated match to d4e1oc_
    complexed with plp, pvh

Details for d4e1ob1

PDB Entry: 4e1o (more details), 1.8 Å

PDB Description: Human histidine decarboxylase complex with Histidine methyl ester (HME)
PDB Compounds: (B:) histidine decarboxylase

SCOPe Domain Sequences for d4e1ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e1ob1 c.67.1.0 (B:2-477) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mepeeyrergremvdyicqylstvrerrvtpdvqpgylraqlpesapedpdswdsifgdi
eriimpgvvhwqsphmhayypaltswpsllgdmladainclgftwasspactelemnvmd
wlakmlglpehflhhhpssqgggvlqstvsestliallaarknkilemktsepdadessl
narlvayasdqahssvekaglislvkmkflpvddnfslrgealqkaieedkqrglvpvfv
catlgttgvcafdclselgpicareglwlhidaayagtaflcpefrgflkgieyadsftf
npskwmmvhfdctgfwvkdkyklqqtfsvnpiylrhansgvatdfmhwqiplsrrfrsvk
lwfvirsfgvknlqahvrhgtemakyfeslvrndpsfeipakrhlglvvfrlkgpnslte
nvlkeiakagrlflipatiqdkliirftvtsqfttrddilrdwnlirdaatlilsq

SCOPe Domain Coordinates for d4e1ob1:

Click to download the PDB-style file with coordinates for d4e1ob1.
(The format of our PDB-style files is described here.)

Timeline for d4e1ob1: