SCOPe 2.04: Domain d4dz3a_: 4dz3 A:

Lineage for d4dz3a_ (4dz3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (20 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [195739] (2 PDB entries)

8. Domain d4dz3a_: 4dz3 A: [201765]
   automated match to d4dz3b_
   complexed with act, ca, edo, fk5; mutant

Details for d4dz3a_

PDB Entry: 4dz3, 2 Å

PDB Description: Crystal structure of a Peptidyl-prolyl cis-trans isomerase with surface mutation M61H from Burkholderia pseudomallei complexed with FK506

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d4dz3a_:

Sequence; same for both SEQRES and ATOM records:

>d4dz3a_ d.26.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
stvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
hvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv

Timeline for d4dz3a_:

• d4dz3a_ first appeared in SCOPe 2.03
  
• d4dz3a_ appears in SCOPe 2.05
  
• d4dz3a_ appears in the current release, SCOPe 2.08, called d4dz3a1