![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:187410] [195837] (1 PDB entry) |
![]() | Domain d4dyug_: 4dyu G: [201759] automated match to d4dyuk_ complexed with so4, zn |
PDB Entry: 4dyu (more details), 2.75 Å
SCOPe Domain Sequences for d4dyug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dyug_ a.25.1.1 (G:) automated matches {Yersinia pestis [TaxId: 187410]} ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi rkaitevedensadmftaasrdldkflwfiesnie
Timeline for d4dyug_: