| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Yersinia pestis [TaxId:187410] [195837] (1 PDB entry) |
| Domain d4dyue_: 4dyu E: [201757] automated match to d4dyuk_ complexed with so4, zn |
PDB Entry: 4dyu (more details), 2.75 Å
SCOPe Domain Sequences for d4dyue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dyue_ a.25.1.1 (E:) automated matches {Yersinia pestis [TaxId: 187410]}
ellytrndveehvkvatikrlnqmviqfidlslitkqahwnmrganfvavhemldgfrta
ltdhldtfaeravqlggvalgtaqvindktplksyptnihsvqehlkalaeryaivandi
rkaitevedensadmftaasrdldkflwfiesnie
Timeline for d4dyue_: