Lineage for d1mf2h1 (1mf2 H:1-113)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510801Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1510830Domain d1mf2h1: 1mf2 H:1-113 [20175]
    Other proteins in same PDB: d1mf2h2, d1mf2l1, d1mf2l2, d1mf2m1, d1mf2m2, d1mf2n2
    part of Fab F11.2.32 against HIV-1 protease

Details for d1mf2h1

PDB Entry: 1mf2 (more details), 2.6 Å

PDB Description: anti hiv1 protease fab complex
PDB Compounds: (H:) monoclonal antibody f11.2.32

SCOPe Domain Sequences for d1mf2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mf2h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
vtvss

SCOPe Domain Coordinates for d1mf2h1:

Click to download the PDB-style file with coordinates for d1mf2h1.
(The format of our PDB-style files is described here.)

Timeline for d1mf2h1: