Lineage for d4dwra1 (4dwr A:2-481)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009107Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. 3009108Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) (S)
  5. 3009109Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins)
    automatically mapped to Pfam PF01139
  6. 3009122Protein automated matches [194738] (1 species)
    not a true protein
  7. 3009123Species Pyrococcus horikoshii [TaxId:53953] [194739] (1 PDB entry)
  8. 3009124Domain d4dwra1: 4dwr A:2-481 [201747]
    Other proteins in same PDB: d4dwra2, d4dwrb2, d4dwrc2
    automated match to d4dwrc_
    protein/RNA complex; complexed with mn, so4

Details for d4dwra1

PDB Entry: 4dwr (more details), 1.48 Å

PDB Description: rna ligase rtcb/mn2+ complex
PDB Compounds: (A:) tRNA-splicing ligase RtcB

SCOPe Domain Sequences for d4dwra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dwra1 d.261.1.1 (A:2-481) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg

SCOPe Domain Coordinates for d4dwra1:

Click to download the PDB-style file with coordinates for d4dwra1.
(The format of our PDB-style files is described here.)

Timeline for d4dwra1: