Lineage for d4dvrl1 (4dvr L:2-106)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511486Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88520] (19 PDB entries)
  8. 1511520Domain d4dvrl1: 4dvr L:2-106 [201744]
    Other proteins in same PDB: d4dvrg_, d4dvrh1, d4dvrh2, d4dvrl2
    automated match to d1rz7l1
    complexed with 0ly, nag

Details for d4dvrl1

PDB Entry: 4dvr (more details), 2.5 Å

PDB Description: crystal structure of yu2 gp120 core in complex with fab 48d and nbd- 557
PDB Compounds: (L:) Fab 48d light chain

SCOPe Domain Sequences for d4dvrl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dvrl1 b.1.1.1 (L:2-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
iqmtqspssvsasvgdrvtitcrasqdistwlawyqqkpgkapklliyaastlqsgvpsr
fsgsgsgtdfsltinslqpedfatyycqqansfftfgggtkveik

SCOPe Domain Coordinates for d4dvrl1:

Click to download the PDB-style file with coordinates for d4dvrl1.
(The format of our PDB-style files is described here.)

Timeline for d4dvrl1: