| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (17 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
| Domain d4dtgl2: 4dtg L:112-219 [201736] Other proteins in same PDB: d4dtgk1, d4dtgk2, d4dtgl1 automated match to d1dn0a2 complexed with gol, mes, pge |
PDB Entry: 4dtg (more details), 1.8 Å
SCOPe Domain Sequences for d4dtgl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dtgl2 b.1.1.2 (L:112-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d4dtgl2: