Lineage for d4dtgl2 (4dtg L:112-219)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029269Domain d4dtgl2: 4dtg L:112-219 [201736]
    Other proteins in same PDB: d4dtgk1, d4dtgk2, d4dtgl1
    automated match to d1dn0a2
    complexed with gol, mes, pge

Details for d4dtgl2

PDB Entry: 4dtg (more details), 1.8 Å

PDB Description: hemostatic effect of a monoclonal antibody mab 2021 blocking the interaction between fxa and tfpi in a rabbit hemophilia model
PDB Compounds: (L:) Humanized recombinant FAB fragment, FAB 2021, of a murine antibody, light chain

SCOPe Domain Sequences for d4dtgl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dtgl2 b.1.1.2 (L:112-219) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4dtgl2:

Click to download the PDB-style file with coordinates for d4dtgl2.
(The format of our PDB-style files is described here.)

Timeline for d4dtgl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dtgl1