SCOPe 2.07: Domain d4drhd_: 4drh D:

Lineage for d4drhd_ (4drh D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (58 PDB entries)

8. Domain d4drhd_: 4drh D: [201733]
   Other proteins in same PDB: d4drhb1, d4drhb2, d4drhe1, d4drhe2
   automated match to d1n1aa_
   complexed with rap, so4

Details for d4drhd_

PDB Entry: 4drh, 2.3 Å

PDB Description: Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of mTOR at low pH

PDB Compounds: (D:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4drhd_:

Sequence; same for both SEQRES and ATOM records:

>d4drhd_ d.26.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
neesptatvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfds
shdrnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlf
feielldfkge

Timeline for d4drhd_:

• d4drhd_ first appeared in SCOPe 2.03
  
• d4drhd_ appears in SCOPe 2.06
  
• d4drhd_ appears in the current release, SCOPe 2.08