Lineage for d4drha_ (4drh A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2185706Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2185941Protein automated matches [191209] (4 species)
    not a true protein
  7. 2185945Species Human (Homo sapiens) [TaxId:9606] [189839] (44 PDB entries)
  8. 2185990Domain d4drha_: 4drh A: [201731]
    Other proteins in same PDB: d4drhb1, d4drhb2, d4drhe1, d4drhe2
    automated match to d1n1aa_
    complexed with rap, so4

Details for d4drha_

PDB Entry: 4drh (more details), 2.3 Å

PDB Description: Co-crystal structure of the PPIase domain of FKBP51, Rapamycin and the FRB fragment of mTOR at low pH
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d4drha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4drha_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nneesptatvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfd
sshdrnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatl
ffeielldfkge

SCOPe Domain Coordinates for d4drha_:

Click to download the PDB-style file with coordinates for d4drha_.
(The format of our PDB-style files is described here.)

Timeline for d4drha_: